twofeat |
twofeat finds neighbouring pairs of specified features in one or more input sequences. Each feature may be specified by type, name, sense, score, tag/value pairs etc. Their relationship, e.g. their sequence separation or overlap, relative sense and order may also be specified. It writes a standard EMBOSS report file with any such feature pairs identified. By default each pair is written as a single feature but (optionally) they are written in their original form.
For each of the pair of features, you can specify its type name, its sense, its score and any tag/value pairs, amongst other things.
You can then specify the type of relationship that the two features should have as follows:
Minimum and maximum distance between each feature.
Distance measurement (measure from the nearest ends of the two features, from the left ends, from right ends, from the furthest ends.)
Type of overlap (any type of overlap or no overlap is allowed, Overlap required, No overlaps are allowed, Overlap required but one feature must not be completely within the other, Feature A must be completely enclosed within feature B, Feature B must be completely enclosed within feature A).
Feature sense (any sense, in the same sense or in opposite senses)
Feature order (any order, Feature A then feature B, Feature B then feature A)
The program proceeds as follows. For eachs sequence: Identify the features that match the criteria for Feature A Identify the features that match the criteria for Feature B Compare all pairs of features If they satisfy the requirements output them to the report file
By default the resulting pairs of features found are then written to a report file as a single feature from the first postion of the left-most feature to the last position of the right-most feature. You can modify the output to report the pairs of features with no changes made to them.
Without the -twoout option the output report contains just one feature for every pair of features found.
% twofeat tembl:x65923 Finds neighbouring pairs of features in sequence(s) Type of first feature [*]: polyA_signal Type of second feature [*]: polyA_site The minimum distance between the features [0]: 10 The maximum distance between the features [0]: 50 Output report [x65923.twofeat]: |
Go to the input files for this example
Go to the output files for this example
Example 2
The -twoout option makes the output report give the pairs of features found. The output report format type has been changed to display the full original pairs of features in GFF format.
% twofeat -twoout -rformat gff tembl:x65923 Finds neighbouring pairs of features in sequence(s) Type of first feature [*]: polyA_signal Type of second feature [*]: polyA_site The minimum distance between the features [0]: 10 The maximum distance between the features [0]: 50 Output report [x65923.twofeat]: |
Go to the output files for this example
Standard (Mandatory) qualifiers: [-sequence] seqall Sequence(s) filename and optional format, or reference (input USA) -atype string [*] By default every feature in the feature table is allowed. You can set this to be any feature type you wish to allow. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. The type may be wildcarded by using '*'. If you wish to allow more than one type, separate their names with the character '|', eg: *UTR | intron (Any string is accepted) -btype string [*] By default every feature in the feature table is allowed. You can set this to be any feature type you wish to allow. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. The type may be wildcarded by using '*'. If you wish to allow more than one type, separate their names with the character '|', eg: *UTR | intron (Any string is accepted) -minrange integer [0] If this is greater or equal to 'maxrange', then no min or max range is specified (Any integer value) -maxrange integer [0] If this is less than or equal to 'minrange', then no min or max range is specified (Any integer value) [-outfile] report [*.twofeat] Output report file name Additional (Optional) qualifiers (* if not always prompted): -asource string [*] By default any feature source in the feature table is allowed. You can set this to match any feature source you wish to allow. The source name is usually either the name of the program that detected the feature or it is the feature table (eg: EMBL) that the feature came from. The source may be wildcarded by using '*'. If you wish to allow more than one source, separate their names with the character '|', eg: gene* | embl (Any string is accepted) -asense menu [0] By default any feature sense is allowed. You can set this to match the required sense. (Values: 0 (Any sense); + (Forward sense); - (Reverse sense)) -aminscore float [0.0] If this is greater than or equal to the maximum score, then any score is allowed. (Any numeric value) -amaxscore float [0.0] If this is less than or equal to the maximum score, then any score is permitted. (Any numeric value) -atag string [*] Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Some of these tags also have values, for example '/gene' can have the value of the gene name. By default any feature tag in the feature table is allowed. You can set this to match any feature tag you wish to allow. The tag may be wildcarded by using '*'. If you wish to allow more than one tag, separate their names with the character '|', eg: gene | label (Any string is accepted) -avalue string [*] Tag values are the values associated with a feature tag. Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Only some of these tags can have values, for example '/gene' can have the value of the gene name. By default any feature tag value in the feature table is allowed. You can set this to match any feature tag value you wish to allow. The tag value may be wildcarded by using '*'. If you wish to allow more than one tag value, separate their names with the character '|', eg: pax* | 10 (Any string is accepted) -bsource string [*] By default any feature source in the feature table is allowed. You can set this to match any feature source you wish to allow. The source name is usually either the name of the program that detected the feature or it is the feature table (eg: EMBL) that the feature came from. The source may be wildcarded by using '*'. If you wish to allow more than one source, separate their names with the character '|', eg: gene* | embl (Any string is accepted) -bsense menu [0] By default any feature sense is allowed. You can set this to match the required sense. (Values: 0 (Any sense); + (Forward sense); - (Reverse sense)) -bminscore float [0.0] If this is greater than or equal to the maximum score, then any score is allowed. (Any numeric value) -bmaxscore float [0.0] If this is less than or equal to the maximum score, then any score is permitted. (Any numeric value) -btag string [*] Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Some of these tags also have values, for example '/gene' can have the value of the gene name. By default any feature tag in the feature table is allowed. You can set this to match any feature tag you wish to allow. The tag may be wildcarded by using '*'. If you wish to allow more than one tag, separate their names with the character '|', eg: gene | label (Any string is accepted) -bvalue string [*] Tag values are the values associated with a feature tag. Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Only some of these tags can have values, for example '/gene' can have the value of the gene name. By default any feature tag value in the feature table is allowed. You can set this to match any feature tag value you wish to allow. The tag value may be wildcarded by using '*'. If you wish to allow more than one tag value, separate their names with the character '|', eg: pax* | 10 (Any string is accepted) -overlap menu [A] This allows you to specify the allowed overlaps of the features A and B. You can allow any or no overlaps, specify that they must or must not overlap, that one must or must not be wholly enclosed within another feature. (Values: A (Any); O (Overlap required); NO (No overlaps are allowed); NW (Overlap required but not within); AW (A must be all within B); BW (B must be all within A)) -rangetype menu [N] This allows you to specify the positions from which the allowed minimum or maximum distance between the features is measured (Values: N (From nearest ends); L (From left ends); R (From right ends); F (From furthest ends)) -sense menu [A] This allows you to specify the required sense that the two features must be on. This is ignored (always 'Any') when looking at protein sequence features. (Values: A (Any sense); S (Same sense); O (Opposite sense)) -order menu [A] This allows you to specify the required order of the two features. The order is measured from the start positions of the features. This criterion is always applied despite the specified overlap type required. (Values: A (Any); AB (Feature A then feature B); BA (Feature B then feature A)) -twoout toggle [N] If you set this to be true, then the two features themselves will be written out. If it is left as false, then a single feature will be written out covering the two features you found. * -typeout string [misc_feature] If you have specified that the pairs of features that are found should be reported as one feature in the ouput, then you can specify the 'type' name of the new feature here. By default every feature in the feature table is allowed. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. If you specify an invalid feature type name, then the default name 'misc_feature' is used. (Any string is accepted) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -rformat2 string Report format -rname2 string Base file name -rextension2 string File name extension -rdirectory2 string Output directory -raccshow2 boolean Show accession number in the report -rdesshow2 boolean Show description in the report -rscoreshow2 boolean Show the score in the report -rstrandshow2 boolean Show the nucleotide strand in the report -rusashow2 boolean Show the full USA in the report -rmaxall2 integer Maximum total hits to report -rmaxseq2 integer Maximum hits to report for one sequence General qualifiers: -auto boolean Turn off prompts -stdout boolean Write first file to standard output -filter boolean Read first file from standard input, write first file to standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messages |
Standard (Mandatory) qualifiers | Allowed values | Default | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
[-sequence] (Parameter 1) |
Sequence(s) filename and optional format, or reference (input USA) | Readable sequence(s) | Required | ||||||||||||
-atype | By default every feature in the feature table is allowed. You can set this to be any feature type you wish to allow. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. The type may be wildcarded by using '*'. If you wish to allow more than one type, separate their names with the character '|', eg: *UTR | intron | Any string is accepted | * | ||||||||||||
-btype | By default every feature in the feature table is allowed. You can set this to be any feature type you wish to allow. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. The type may be wildcarded by using '*'. If you wish to allow more than one type, separate their names with the character '|', eg: *UTR | intron | Any string is accepted | * | ||||||||||||
-minrange | If this is greater or equal to 'maxrange', then no min or max range is specified | Any integer value | 0 | ||||||||||||
-maxrange | If this is less than or equal to 'minrange', then no min or max range is specified | Any integer value | 0 | ||||||||||||
[-outfile] (Parameter 2) |
Output report file name | Report output file | <*>.twofeat | ||||||||||||
Additional (Optional) qualifiers | Allowed values | Default | |||||||||||||
-asource | By default any feature source in the feature table is allowed. You can set this to match any feature source you wish to allow. The source name is usually either the name of the program that detected the feature or it is the feature table (eg: EMBL) that the feature came from. The source may be wildcarded by using '*'. If you wish to allow more than one source, separate their names with the character '|', eg: gene* | embl | Any string is accepted | * | ||||||||||||
-asense | By default any feature sense is allowed. You can set this to match the required sense. |
|
0 | ||||||||||||
-aminscore | If this is greater than or equal to the maximum score, then any score is allowed. | Any numeric value | 0.0 | ||||||||||||
-amaxscore | If this is less than or equal to the maximum score, then any score is permitted. | Any numeric value | 0.0 | ||||||||||||
-atag | Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Some of these tags also have values, for example '/gene' can have the value of the gene name. By default any feature tag in the feature table is allowed. You can set this to match any feature tag you wish to allow. The tag may be wildcarded by using '*'. If you wish to allow more than one tag, separate their names with the character '|', eg: gene | label | Any string is accepted | * | ||||||||||||
-avalue | Tag values are the values associated with a feature tag. Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Only some of these tags can have values, for example '/gene' can have the value of the gene name. By default any feature tag value in the feature table is allowed. You can set this to match any feature tag value you wish to allow. The tag value may be wildcarded by using '*'. If you wish to allow more than one tag value, separate their names with the character '|', eg: pax* | 10 | Any string is accepted | * | ||||||||||||
-bsource | By default any feature source in the feature table is allowed. You can set this to match any feature source you wish to allow. The source name is usually either the name of the program that detected the feature or it is the feature table (eg: EMBL) that the feature came from. The source may be wildcarded by using '*'. If you wish to allow more than one source, separate their names with the character '|', eg: gene* | embl | Any string is accepted | * | ||||||||||||
-bsense | By default any feature sense is allowed. You can set this to match the required sense. |
|
0 | ||||||||||||
-bminscore | If this is greater than or equal to the maximum score, then any score is allowed. | Any numeric value | 0.0 | ||||||||||||
-bmaxscore | If this is less than or equal to the maximum score, then any score is permitted. | Any numeric value | 0.0 | ||||||||||||
-btag | Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Some of these tags also have values, for example '/gene' can have the value of the gene name. By default any feature tag in the feature table is allowed. You can set this to match any feature tag you wish to allow. The tag may be wildcarded by using '*'. If you wish to allow more than one tag, separate their names with the character '|', eg: gene | label | Any string is accepted | * | ||||||||||||
-bvalue | Tag values are the values associated with a feature tag. Tags are the types of extra values that a feature may have. For example in the EMBL feature table, a 'CDS' type of feature may have the tags '/codon', '/codon_start', '/db_xref', '/EC_number', '/evidence', '/exception', '/function', '/gene', '/label', '/map', '/note', '/number', '/partial', '/product', '/protein_id', '/pseudo', '/standard_name', '/translation', '/transl_except', '/transl_table', or '/usedin'. Only some of these tags can have values, for example '/gene' can have the value of the gene name. By default any feature tag value in the feature table is allowed. You can set this to match any feature tag value you wish to allow. The tag value may be wildcarded by using '*'. If you wish to allow more than one tag value, separate their names with the character '|', eg: pax* | 10 | Any string is accepted | * | ||||||||||||
-overlap | This allows you to specify the allowed overlaps of the features A and B. You can allow any or no overlaps, specify that they must or must not overlap, that one must or must not be wholly enclosed within another feature. |
|
A | ||||||||||||
-rangetype | This allows you to specify the positions from which the allowed minimum or maximum distance between the features is measured |
|
N | ||||||||||||
-sense | This allows you to specify the required sense that the two features must be on. This is ignored (always 'Any') when looking at protein sequence features. |
|
A | ||||||||||||
-order | This allows you to specify the required order of the two features. The order is measured from the start positions of the features. This criterion is always applied despite the specified overlap type required. |
|
A | ||||||||||||
-twoout | If you set this to be true, then the two features themselves will be written out. If it is left as false, then a single feature will be written out covering the two features you found. | Toggle value Yes/No | No | ||||||||||||
-typeout | If you have specified that the pairs of features that are found should be reported as one feature in the ouput, then you can specify the 'type' name of the new feature here. By default every feature in the feature table is allowed. See http://www3.ebi.ac.uk/Services/WebFeat/ for a list of the EMBL feature types and see Appendix A of the Swissprot user manual in http://www.expasy.ch/txt/userman.txt for a list of the Swissprot feature types. If you specify an invalid feature type name, then the default name 'misc_feature' is used. | Any string is accepted | misc_feature | ||||||||||||
Advanced (Unprompted) qualifiers | Allowed values | Default | |||||||||||||
(none) |
ID X65923; SV 1; linear; mRNA; STD; HUM; 518 BP. XX AC X65923; XX DT 13-MAY-1992 (Rel. 31, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 11) XX DE H.sapiens fau mRNA XX KW fau gene. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-518 RA Michiels L.M.R.; RT ; RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases. RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry, RL Universiteisplein 1, 2610 Wilrijk, BELGIUM XX RN [2] RP 1-518 RX PUBMED; 8395683. RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.; RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as RT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus"; RL Oncogene 8(9):2537-2546(1993). XX DR H-InvDB; HIT000322806. XX FH Key Location/Qualifiers FH FT source 1..518 FT /organism="Homo sapiens" FT /chromosome="11q" FT /map="13" FT /mol_type="mRNA" FT /clone_lib="cDNA" FT /clone="pUIA 631" FT /tissue_type="placenta" FT /db_xref="taxon:9606" FT misc_feature 57..278 FT /note="ubiquitin like part" FT CDS 57..458 FT /gene="fau" FT /db_xref="GDB:135476" FT /db_xref="GOA:P35544" FT /db_xref="GOA:P62861" FT /db_xref="HGNC:3597" FT /db_xref="UniProtKB/Swiss-Prot:P35544" FT /db_xref="UniProtKB/Swiss-Prot:P62861" FT /protein_id="CAA46716.1" FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS" FT misc_feature 98..102 FT /note="nucleolar localization signal" FT misc_feature 279..458 FT /note="S30 part" FT polyA_signal 484..489 FT polyA_site 509 XX SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518 // |
The output is a standard EMBOSS report file.
The results can be output in one of several styles by using the command-line qualifier -rformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel, feattable, motif, regions, seqtable, simple, srs, table, tagseq
See: http://emboss.sf.net/docs/themes/ReportFormats.html for further information on report formats.
twofeat outputs a report format file. The default format is table
######################################## # Program: twofeat # Rundate: Tue 15 Jul 2008 12:00:00 # Commandline: twofeat # [-sequence] tembl:x65923 # -atype polyA_signal # -btype polyA_site # -minrange 10 # -maxrange 50 # Report_format: table # Report_file: x65923.twofeat ######################################## #======================================= # # Sequence: X65923 from: 1 to: 518 # HitCount: 1 #======================================= Start End Strand Score starta enda startb endb 484 509 + 0.000 484 489 509 509 #--------------------------------------- #--------------------------------------- #--------------------------------------- # Total_sequences: 1 # Total_hitcount: 1 #--------------------------------------- |
##gff-version 3 ##sequence-region X65923 1 518 #!Date 2008-07-15 #!Type DNA #!Source-version EMBOSS 6.0.0 X65923 EMBL polyA_signal_sequence 484 489 0.000 + . ID="X65923.6" X65923 EMBL polyA_site 509 509 0.000 + . ID="X65923.7";featflags="0x40" |
twofeat is intended for use as a simple data-mining tool to enable you to look for instances of pairs of features that occur near to each other in the same sequence entry.
Program name | Description |
---|---|
coderet | Extract CDS, mRNA and translations from feature tables |
extractfeat | Extract features from sequence(s) |
maskfeat | Write a sequence with masked features |
showfeat | Display features of a sequence in pretty format |