LOCUS       Y17812                   760 bp    DNA     linear   PLN 14-NOV-2006
DEFINITION  Isoetes lacustris mitochondrial nad1 gene.
ACCESSION   Y17812
VERSION     Y17812.1  GI:3355610
KEYWORDS    nad1 gene; NADH dehydrogenase subunit 1.
SOURCE      mitochondrion Isoetes lacustris
  ORGANISM  Isoetes lacustris
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Lycopodiophyta; Isoetopsida; Isoetales; Isoetaceae; Isoetes.
REFERENCE   1
  AUTHORS   Malek,O. and Knoop,V.
  TITLE     Trans-splicing group II introns in plant mitochondria: the complete
            set of cis-arranged homologs in ferns, fern allies, and a hornwort
  JOURNAL   RNA 4 (12), 1599-1609 (1998)
   PUBMED   9848656
REFERENCE   2  (bases 1 to 760)
  AUTHORS   Malek,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JUL-1998) O. Malek, Replicon GmbH, Tempelhofer Weg
            11-12, D-10829 Berlin, FRG
FEATURES             Location/Qualifiers
     source          1..760
                     /organism="Isoetes lacustris"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:50271"
     gene            <1..>760
                     /gene="nad1"
     CDS             join(<1..217,738..>760)
                     /gene="nad1"
                     /exception="RNA editing"
                     /codon_start=1
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="CAA76866.1"
                     /db_xref="GI:3355611"
                     /db_xref="GOA:O79357"
                     /db_xref="InterPro:IPR001694"
                     /db_xref="UniProtKB/TrEMBL:O79357"
                     /translation="KSILKEPILPSSANFPPPPTALIITSMSGLVARAVISLDYGMAL
                     PDFNVGTLHLFAIPFPGVYGIITAGRPSNPKYAFSG"
     exon            <1..217
                     /gene="nad1"
                     /number=1
     misc_feature    46
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    47
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    50
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    52
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    53
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    55
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    56
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    59
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    65
                     /gene="nad1"
                     /note="U to C RNA editing" by Kei Yura based on the paper
     misc_feature    77
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    83
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    97
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    109
                     /gene="nad1"
                     /note="U to C RNA editing" by Kei Yura based on the paper
     misc_feature    112
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    128
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    133
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    157
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    172
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    176
                     /gene="nad1"
                     /note="U to C RNA editing" by Kei Yura based on the paper
     misc_feature    200
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    208
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    211
                     /gene="nad1"
                     /note="C to U RNA editing"
     intron          218..737
                     /gene="nad1"
                     /note="group II"
                     /number=1
     exon            738..>760
                     /gene="nad1"
                     /number=2
     misc_feature    740
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    748
                     /gene="nad1"
                     /note="C to U RNA editing"
     misc_feature    756
                     /gene="nad1"
                     /note="C to U RNA editing"
ORIGIN      
        1 aaatcaattc taaaagaacc tattttaccg agtagtgcta atttccctcc tcctccaacg
       61 gctctaataa ttacatctat gtcaggtttg gttgctcggg ccgtcatatc tcttgattat
      121 ggtatggcat taccagattt caatgtaggt acacttcatt tattcgccat tccttttcca
      181 ggtgtttatg gaattattac ggcgggtcgg cctagtaggg cggccgtttg gtcgcctatg
      241 gaaccagagg tcggtctact acttcttcta ggtgstggtt tctttcttgc tgcttgctac
      301 gtacgagatg aatgaggtgc rtccacgaac aacgctgtcc cgtttcctct cctgctggga
      361 ccgctcrcca acgtgaaaac aaacatattc ctagttgaga cgacatcatc tcgatttcct
      421 aatactaggg gatgggagcc ataggtgata ccggcgatat ccagccagat tgttattgtt
      481 ggtagtcaga ggacccatag tacccaagaa gaggttggga aaggggtcgt tttctcgact
      541 gactccccgt catcattcat gttagctgct aatccctcgt gggaggaaga agaggatgtk
      601 aagaagcaag ctacaacaaa cacatcacat ttccgcaagc aaggttgggg gatagagccg
      661 tatgcgcggt gacgtgctcg tacggttcgg agaggactct acaccgctgg ctgtggtgga
      721 tggtggtttc actctgtatc ccaaatacgc tttttcagga
//