LOCUS Y14435 1776 bp mRNA linear PLN 11-AUG-1998 DEFINITION Triticum aestivum mitochondrial NADH dehydrogenase subunit 2. ACCESSION Y14435 VERSION Y14435.1 GI:2326761 KEYWORDS mitochondrion; nad2 gene; NADH dehydrogenase subunit 2. SOURCE mitochondrion Triticum aestivum (bread wheat) ORGANISM Triticum aestivum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Pooideae; Triticeae; Triticum. REFERENCE 1 AUTHORS Morawala-Patell,V., Gualberto,J.M., Lamattina,L., Grienenberger,J.M. and Bonnard,G. TITLE Cis- and trans-splicing and RNA editing are required for the expression of nad2 in wheat mitochondria JOURNAL Mol. Gen. Genet. 258 (5), 503-511 (1998) PUBMED 9669332 REFERENCE 2 (bases 1 to 1776) AUTHORS Bonnard,G. TITLE Direct Submission JOURNAL Submitted (05-AUG-1997) G. Bonnard, Institut de Biologie Moleculaire des Plantes du CNRS, 12 Rue du General Zimmer, 67084 Strasbourg Cedex, FRANCE FEATURES Location/Qualifiers source 1..1776 /organism="Triticum aestivum" /organelle="mitochondrion" /mol_type="mRNA" /strain="Capitole" /cultivar="Capitole" /db_xref="taxon:4565" /tissue_type="etiolated seedlings" gene 1..1776 /gene="nad2" CDS 271..1737 /gene="nad2" /codon_start=1 /product="NADH dehydrogenase subunit 2" /protein_id="CAA74779.1" /db_xref="GI:2326762" /db_xref="GOA:O21360" /db_xref="InterPro:IPR001750" /db_xref="InterPro:IPR010096" /db_xref="UniProtKB/TrEMBL:O21360" /translation="MFNLFLAVFPEIFIINATFILLIHGVVFSTSKKDDYPPLVSNVG WLGLLSVLITLLLLAAGAPLLTIAHLFWNNFFRRDNFTYFCQILLLLSTAGTISMCFD FFEKERFDAFEFIVLILLSTCSMLLMISAYDLIAMYLAIELQSLCFYVIAASKRKSEF STEAGLKYLILGAFSSGILLFGCSMIYGSTGATHFDQLAKILTGYEITGARSSGIFMG ILFIAVGFLFKITAVPFHMWAPDIYEGSPTPVTAFLSIAPKISIFANMLRVFIVASYG GTLQQIFFFCSIASMILGALAAMAQTKVKRLLAYSSIGHVGYICIGFSCGTIEGIQSL LIGIFIYALMTIDAFAIVLALRQTRVKYIADLGALAKTNPILAMTFSITMFSYAGIPP LAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKRMFFDRPRTWILYEPM DRDKSLLLAMTSSFIILFFLYPSSLFDLTHQMALSLYL" misc_feature 296 modified by Kei Yura based on the paper /gene="nad2" /note="C to U RNA editing" misc_feature 573 /gene="nad2" /note="C to U RNA editing" misc_feature 605 /gene="nad2" /note="C to U RNA editing" misc_feature 626 /gene="nad2" /note="C to U RNA editing" misc_feature 631 /gene="nad2" /note="C to U RNA editing" misc_feature 637 /gene="nad2" /note="C to U RNA editing" misc_feature 658 /gene="nad2" /note="C to U RNA editing" misc_feature 664 /gene="nad2" /note="C to U RNA editing" misc_feature 767 /gene="nad2" /note="C to U RNA editing" misc_feature 793 /gene="nad2" /note="C to U RNA editing" misc_feature 891 /gene="nad2" /note="C to U RNA editing" misc_feature 954 /gene="nad2" /note="C to U RNA editing" misc_feature 1058 /gene="nad2" /note="C to U RNA editing" misc_feature 1070 added by Kei Yura based on the paper /gene="nad2" /note="C to U RNA editing" misc_feature 1079 /gene="nad2" /note="C to U RNA editing" misc_feature 1190 /gene="nad2" /note="C to U RNA editing" misc_feature 1198 /gene="nad2" /note="C to U RNA editing" misc_feature 1228 /gene="nad2" /note="C to U RNA editing" misc_feature 1232 /gene="nad2" /note="C to U RNA editing" misc_feature 1298 /gene="nad2" /note="C to U RNA editing" misc_feature 1327 /gene="nad2" /note="C to U RNA editing" misc_feature 1328 /gene="nad2" /note="C to U RNA editing" misc_feature 1397 /gene="nad2" /note="C to U RNA editing" misc_feature 1516 /gene="nad2" /note="C to U RNA editing" misc_feature 1517 /gene="nad2" /note="C to U RNA editing" misc_feature 1546 /gene="nad2" /note="C to U RNA editing" misc_feature 1568 /gene="nad2" /note="C to U RNA editing" misc_feature 1667 /gene="nad2" /note="C to U RNA editing" misc_feature 1670 /gene="nad2" /note="C to U RNA editing" misc_feature 1673 /gene="nad2" /note="C to U RNA editing" misc_feature 1674 /gene="nad2" /note="C to U RNA editing" misc_feature 1678 /gene="nad2" /note="C to U RNA editing" misc_feature 1679 /gene="nad2" /note="C to U RNA editing" misc_feature 1686 /gene="nad2" /note="C to U RNA editing" misc_feature 1690 /gene="nad2" /note="C to U RNA editing" misc_feature 1727 /gene="nad2" /note="C to U RNA editing" ORIGIN 1 tagtttcaaa tagagattgt gtgggtgtga agtgtactga agatcgaggt ttttcttctt 61 actaactttg tcaaagaggc taaaaaaaca ataaatgacc aacgaaactt cgagtgagta 121 ggataaggag gagtagtcgg aggatcttag aagggaatta gagaaaaaag agcagcagct 181 cagtaataac acctaggctt ttgaattaac tctgcgattt ggaagacgga ggaaatgaaa 241 gtagaagaag ttatcgaaac tcggaaccac atgttcaatc tttttttagc ggttttccca 301 gagatcttta tcattaacgc aaccttcatt ttgctcattc atggagttgt atttagtacc 361 tctaagaaag atgattatcc accgttagtt agtaatgtgg gttggcttgg attacttagt 421 gttctaataa ccttgcttct gctcgccgct ggcgcacctc tcctaactat tgcccattta 481 ttctggaata atttttttag gagggacaat tttacatatt tctgccaaat ccttctatta 541 ttaagtacgg ctggtaccat ttcgatgtgt tttgattttt tcgaaaaaga gaggtttgat 601 gcttttgaat tcattgtatt aattctactt tctacttgca gtatgctctt aatgatctcg 661 gcttatgatt taattgccat gtatttagct attgagcttc aaagtttatg tttttatgtg 721 atcgcagcat caaaaagaaa gtctgaattt tccacggaag ccggcttaaa atatttgatc 781 ttaggtgcat tttcctctgg aatattattg ttcggttgtt ccatgatcta tgggtctact 841 ggagctaccc acttcgatca attagccaag attttgaccg gatacgaaat tactggtgct 901 cgatctagtg gtatttttat ggggattctt tttatcgctg taggattcct atttaagatt 961 actgcagttc cttttcatat gtgggcacct gatatctatg agggttcacc caccccggtg 1021 acagcattcc tttctattgc gcctaaaatc tctatttttg caaatatgtt acgtgttttt 1081 attgttgctt cctatggggg tacattacaa caaatcttct ttttctgcag cattgcttct 1141 atgatcttag gagcactggc cgccatggcc caaacgaaag tcaaaagact tctagcttat 1201 agttcgattg gacatgtagg ttatatttgt attggtttct catgtggaac catagaagga 1261 attcaatcac tactaattgg tatatttatt tatgcattaa tgacgataga tgcattcgcc 1321 atagttttag cattacggca aacccgtgtc aaatatatag cggatttggg cgctctagcc 1381 aaaacgaatc ctattttggc tatgaccttc tccattacaa tgttctcata cgcaggaata 1441 cccccgttag ccggcttttg tagcaaattc tatttgttct tcgccgcttt gggttgtggg 1501 gcttacttcc tagccttagt gggagtagtg actagcgtta taggttgttt ttattatata 1561 cgcttagtga aaagaatgtt ttttgataga cctaggacat ggattctata tgaaccaatg 1621 gatcgtgaca agtcgttact actagcaatg acttcctctt tcattatttt atttttttta 1681 tatccttctt ccttgttcga tcttactcat caaatggcac tcagtttata tctgtaagtt 1741 cgttcgatca ttgacaaggt tcaaagaaag ggtggg //